Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3076969..3077648 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF90 |
Locus tag | DKC2_RS15120 | Protein ID | WP_003414059.1 |
Coordinates | 3076969..3077385 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | DKC2_RS15125 | Protein ID | WP_003414061.1 |
Coordinates | 3077382..3077648 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS15100 | 3073021..3073923 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
DKC2_RS15105 | 3073992..3074744 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
DKC2_RS15110 | 3074988..3075263 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
DKC2_RS15115 | 3075260..3076882 | - | 1623 | WP_003906897.1 | type I restriction-modification system subunit M | - |
DKC2_RS15120 | 3076969..3077385 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
DKC2_RS15125 | 3077382..3077648 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
DKC2_RS15130 | 3077674..3078069 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS15135 | 3078066..3078335 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
DKC2_RS15140 | 3078345..3079439 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
DKC2_RS15145 | 3079436..3079855 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
DKC2_RS15150 | 3079929..3080408 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
DKC2_RS15155 | 3080479..3081279 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
DKC2_RS15160 | 3081435..3082172 | + | 738 | WP_031746397.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T285970 WP_003414059.1 NZ_LR027516:c3077385-3076969 [Mycobacterium tuberculosis]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|