Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2938069..2938783 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag DKC2_RS14275 Protein ID WP_003413460.1
Coordinates 2938343..2938783 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag DKC2_RS14270 Protein ID WP_003413456.1
Coordinates 2938069..2938356 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS14235 2933491..2933736 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
DKC2_RS14240 2933733..2934137 + 405 WP_003899389.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS14245 2934354..2934974 + 621 WP_003413441.1 DUF4178 domain-containing protein -
DKC2_RS14250 2934985..2935479 + 495 WP_003413444.1 DUF2617 family protein -
DKC2_RS14255 2935476..2935907 + 432 WP_003899390.1 DUF4247 domain-containing protein -
DKC2_RS14260 2935932..2936390 + 459 WP_003413451.1 DUF350 domain-containing protein -
DKC2_RS14265 2936387..2937958 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
DKC2_RS14270 2938069..2938356 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
DKC2_RS14275 2938343..2938783 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS14280 2938804..2939559 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
DKC2_RS14285 2939692..2940288 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
DKC2_RS14290 2940296..2941141 - 846 WP_003413466.1 acyl-CoA thioesterase II -
DKC2_RS14295 2941170..2942069 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
DKC2_RS14300 2942197..2942871 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T285968 WP_003413460.1 NZ_LR027516:2938343-2938783 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT285968 WP_003413456.1 NZ_LR027516:2938069-2938356 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References