Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2876161..2876870 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag DKC2_RS13970 Protein ID WP_003413164.1
Coordinates 2876161..2876574 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag DKC2_RS13975 Protein ID WP_031746422.1
Coordinates 2876613..2876870 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS13935 2871214..2872419 - 1206 WP_003413027.1 chorismate synthase -
DKC2_RS13940 2872527..2872841 + 315 WP_009937839.1 hypothetical protein -
DKC2_RS13945 2873137..2874348 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
DKC2_RS13955 2874475..2875134 + 660 WP_003900846.1 LppA family lipoprotein -
DKC2_RS13960 2875131..2875793 + 663 WP_003900848.1 hypothetical protein -
DKC2_RS13965 2875790..2876068 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
DKC2_RS13970 2876161..2876574 + 414 WP_003413164.1 PIN domain nuclease Toxin
DKC2_RS13975 2876613..2876870 + 258 WP_031746422.1 ribbon-helix-helix domain-containing protein Antitoxin
DKC2_RS13980 2876867..2877244 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS13985 2877260..2877634 - 375 WP_003413177.1 hypothetical protein -
DKC2_RS13990 2877734..2878129 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
DKC2_RS13995 2878126..2878371 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
DKC2_RS14005 2878782..2879201 - 420 WP_003413190.1 A24 family peptidase -
DKC2_RS14010 2879213..2880022 - 810 WP_003413193.1 shikimate dehydrogenase -
DKC2_RS14015 2880019..2881272 - 1254 WP_003413196.1 endolytic transglycosylase MltG -
DKC2_RS14020 2881265..2881777 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T285965 WP_003413164.1 NZ_LR027516:2876161-2876574 [Mycobacterium tuberculosis]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9465.69 Da        Isoelectric Point: 10.6555

>AT285965 WP_031746422.1 NZ_LR027516:2876613-2876870 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFIGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure

References