Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2862274..2862914 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag DKC2_RS13880 Protein ID WP_003412970.1
Coordinates 2862274..2862693 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag DKC2_RS13885 Protein ID WP_003412975.1
Coordinates 2862690..2862914 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS13850 2857859..2858581 - 723 WP_003412957.1 DUF1906 domain-containing protein -
DKC2_RS13860 2859098..2859325 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
DKC2_RS13865 2859322..2859723 + 402 WP_003412963.1 PIN domain-containing protein -
DKC2_RS13870 2859758..2860678 - 921 WP_003412965.1 restriction endonuclease -
DKC2_RS21665 2861019..2861264 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
DKC2_RS13875 2861323..2862273 + 951 WP_003911916.1 Lsr2 family protein -
DKC2_RS13880 2862274..2862693 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS13885 2862690..2862914 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
DKC2_RS13890 2862945..2865788 - 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
DKC2_RS13895 2865860..2866261 - 402 WP_003412981.1 hypothetical protein -
DKC2_RS13900 2866261..2866731 - 471 WP_003899364.1 transcription antitermination factor NusB -
DKC2_RS13905 2866734..2867297 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T285964 WP_003412970.1 NZ_LR027516:c2862693-2862274 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT285964 WP_003412975.1 NZ_LR027516:c2862914-2862690 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References