Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2411518..2412047 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag DKC2_RS11685 Protein ID WP_003411124.1
Coordinates 2411518..2411835 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag DKC2_RS11690 Protein ID WP_003411127.1
Coordinates 2411832..2412047 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS11655 2406655..2407731 + 1077 WP_003411110.1 hypothetical protein -
DKC2_RS11660 2407728..2408009 + 282 WP_003411112.1 hypothetical protein -
DKC2_RS11665 2408045..2409118 + 1074 WP_003411116.1 quinone-dependent dihydroorotate dehydrogenase -
DKC2_RS11670 2409123..2409653 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
DKC2_RS11675 2409701..2411047 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
DKC2_RS11685 2411518..2411835 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DKC2_RS11690 2411832..2412047 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
DKC2_RS11695 2412302..2413360 + 1059 WP_003411129.1 hypothetical protein -
DKC2_RS11700 2413490..2413846 - 357 WP_003411130.1 hypothetical protein -
DKC2_RS11705 2413941..2414723 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
DKC2_RS11710 2414991..2415281 - 291 WP_003900476.1 YggT family protein -
DKC2_RS11715 2415443..2416099 - 657 WP_003411133.1 cell division protein SepF -
DKC2_RS11720 2416165..2416941 - 777 WP_003411137.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T285962 WP_003411124.1 NZ_LR027516:c2411835-2411518 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT285962 WP_003411127.1 NZ_LR027516:c2412047-2411832 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References