Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/- |
| Location | 2411518..2412047 | Replicon | chromosome |
| Accession | NZ_LR027516 | ||
| Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TMR4 |
| Locus tag | DKC2_RS11685 | Protein ID | WP_003411124.1 |
| Coordinates | 2411518..2411835 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P9WJ74 |
| Locus tag | DKC2_RS11690 | Protein ID | WP_003411127.1 |
| Coordinates | 2411832..2412047 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKC2_RS11655 | 2406655..2407731 | + | 1077 | WP_003411110.1 | hypothetical protein | - |
| DKC2_RS11660 | 2407728..2408009 | + | 282 | WP_003411112.1 | hypothetical protein | - |
| DKC2_RS11665 | 2408045..2409118 | + | 1074 | WP_003411116.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| DKC2_RS11670 | 2409123..2409653 | - | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| DKC2_RS11675 | 2409701..2411047 | - | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
| DKC2_RS11685 | 2411518..2411835 | - | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DKC2_RS11690 | 2411832..2412047 | - | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
| DKC2_RS11695 | 2412302..2413360 | + | 1059 | WP_003411129.1 | hypothetical protein | - |
| DKC2_RS11700 | 2413490..2413846 | - | 357 | WP_003411130.1 | hypothetical protein | - |
| DKC2_RS11705 | 2413941..2414723 | - | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
| DKC2_RS11710 | 2414991..2415281 | - | 291 | WP_003900476.1 | YggT family protein | - |
| DKC2_RS11715 | 2415443..2416099 | - | 657 | WP_003411133.1 | cell division protein SepF | - |
| DKC2_RS11720 | 2416165..2416941 | - | 777 | WP_003411137.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T285962 WP_003411124.1 NZ_LR027516:c2411835-2411518 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAJ4 |