Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2374770..2375465 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | DKC2_RS11480 | Protein ID | WP_003410811.1 |
Coordinates | 2374770..2375204 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | DKC2_RS11485 | Protein ID | WP_003410814.1 |
Coordinates | 2375211..2375465 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS11470 | 2370924..2373965 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
DKC2_RS11475 | 2373958..2374791 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
DKC2_RS11480 | 2374770..2375204 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DKC2_RS11485 | 2375211..2375465 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
DKC2_RS11490 | 2375481..2375738 | - | 258 | WP_003410816.1 | hypothetical protein | - |
DKC2_RS11500 | 2376685..2376981 | + | 297 | WP_003410820.1 | PE family protein | - |
DKC2_RS11505 | 2377037..2377768 | + | 732 | WP_003900467.1 | PPE family protein | - |
DKC2_RS11510 | 2378308..2379054 | - | 747 | WP_003906749.1 | proteasome subunit alpha | - |
DKC2_RS11515 | 2379051..2379926 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
DKC2_RS11520 | 2379923..2380117 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T285961 WP_003410811.1 NZ_LR027516:c2375204-2374770 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |