Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2331515..2332151 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | DKC2_RS11285 | Protein ID | WP_003410654.1 |
Coordinates | 2331741..2332151 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | DKC2_RS11280 | Protein ID | WP_003410651.1 |
Coordinates | 2331515..2331748 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS11270 | 2327365..2327769 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
DKC2_RS11275 | 2327853..2331437 | - | 3585 | WP_003410648.1 | cobaltochelatase subunit CobN | - |
DKC2_RS11280 | 2331515..2331748 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
DKC2_RS11285 | 2331741..2332151 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
DKC2_RS11290 | 2332135..2333226 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
DKC2_RS11295 | 2333236..2333862 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
DKC2_RS11300 | 2333859..2335385 | + | 1527 | WP_031746400.1 | precorrin-2 C(20)-methyltransferase | - |
DKC2_RS11305 | 2335331..2336554 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T285960 WP_003410654.1 NZ_LR027516:2331741-2332151 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|