Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2244989..2245575 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | DKC2_RS10895 | Protein ID | WP_003410010.1 |
Coordinates | 2244989..2245333 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | DKC2_RS10900 | Protein ID | WP_003410014.1 |
Coordinates | 2245327..2245575 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS10855 | 2240695..2241294 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
DKC2_RS10860 | 2241710..2242138 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
DKC2_RS10865 | 2242364..2242903 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
DKC2_RS10875 | 2243423..2243983 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
DKC2_RS10880 | 2243980..2244321 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
DKC2_RS10885 | 2244407..2244664 | + | 258 | WP_003410006.1 | hypothetical protein | - |
DKC2_RS10890 | 2244565..2244900 | - | 336 | WP_003410009.1 | dehydrogenase | - |
DKC2_RS10895 | 2244989..2245333 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
DKC2_RS10900 | 2245327..2245575 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
DKC2_RS10905 | 2245675..2247990 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
DKC2_RS10910 | 2247987..2248259 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
DKC2_RS10915 | 2248312..2248668 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
DKC2_RS10920 | 2248825..2249592 | + | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T285957 WP_003410010.1 NZ_LR027516:c2245333-2244989 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|