Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2214364..2214908 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag DKC2_RS10695 Protein ID WP_003409896.1
Coordinates 2214364..2214660 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag DKC2_RS10700 Protein ID WP_003409899.1
Coordinates 2214657..2214908 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS10640 2209397..2209747 - 351 WP_003899096.1 hypothetical protein -
DKC2_RS10645 2209758..2210660 - 903 WP_003899097.1 hypothetical protein -
DKC2_RS10650 2210681..2210872 - 192 WP_003409876.1 hypothetical protein -
DKC2_RS10655 2210873..2211169 - 297 WP_003409877.1 hypothetical protein -
DKC2_RS10660 2211409..2211624 + 216 WP_003409878.1 antitoxin -
DKC2_RS10665 2211621..2211932 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS21630 2211906..2212427 - 522 WP_003904745.1 hypothetical protein -
DKC2_RS10675 2212402..2212779 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
DKC2_RS10680 2212821..2213270 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
DKC2_RS10685 2213267..2213812 + 546 WP_003409891.1 SecB-like chaperone -
DKC2_RS10690 2213701..2214315 - 615 WP_003901296.1 hypothetical protein -
DKC2_RS10695 2214364..2214660 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
DKC2_RS10700 2214657..2214908 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
DKC2_RS10705 2214895..2215389 + 495 WP_003899099.1 hypothetical protein -
DKC2_RS10710 2215549..2215956 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS10715 2215960..2216232 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
DKC2_RS10720 2216265..2217485 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
DKC2_RS10735 2218384..2219181 + 798 WP_003899101.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T285954 WP_003409896.1 NZ_LR027516:c2214660-2214364 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT285954 WP_003409899.1 NZ_LR027516:c2214908-2214657 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References