Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2205327..2206030 | Replicon | chromosome |
| Accession | NZ_LR027516 | ||
| Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | DKC2_RS10605 | Protein ID | WP_003409778.1 |
| Coordinates | 2205327..2205656 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | DKC2_RS10610 | Protein ID | WP_003409780.1 |
| Coordinates | 2205653..2206030 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKC2_RS10585 | 2201710..2202780 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
| DKC2_RS10590 | 2202777..2203292 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
| DKC2_RS10595 | 2203289..2204350 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| DKC2_RS10600 | 2204347..2205117 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| DKC2_RS10605 | 2205327..2205656 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DKC2_RS10610 | 2205653..2206030 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| DKC2_RS10615 | 2206027..2206617 | - | 591 | WP_003409784.1 | SEC-C domain-containing protein | - |
| DKC2_RS10620 | 2206672..2208036 | + | 1365 | WP_003899094.1 | HNH endonuclease | - |
| DKC2_RS10625 | 2208191..2208643 | - | 453 | WP_003899095.1 | lipoprotein | - |
| DKC2_RS10630 | 2208707..2209108 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| DKC2_RS10635 | 2209101..2209283 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| DKC2_RS10640 | 2209397..2209747 | - | 351 | WP_003899096.1 | hypothetical protein | - |
| DKC2_RS10645 | 2209758..2210660 | - | 903 | WP_003899097.1 | hypothetical protein | - |
| DKC2_RS10650 | 2210681..2210872 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T285952 WP_003409778.1 NZ_LR027516:c2205656-2205327 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT285952 WP_003409780.1 NZ_LR027516:c2206030-2205653 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|