Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1953770..1954383 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | DKC2_RS09405 | Protein ID | WP_003408465.1 |
Coordinates | 1953770..1954159 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | DKC2_RS09410 | Protein ID | WP_003408469.1 |
Coordinates | 1954156..1954383 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS09375 | 1949399..1950313 | + | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
DKC2_RS09380 | 1950316..1951146 | + | 831 | WP_003916363.1 | cyclase family protein | - |
DKC2_RS09385 | 1951146..1951496 | + | 351 | WP_003898986.1 | cupin domain-containing protein | - |
DKC2_RS09390 | 1951549..1952367 | + | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
DKC2_RS09395 | 1952381..1953160 | + | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
DKC2_RS09405 | 1953770..1954159 | - | 390 | WP_003408465.1 | PIN domain-containing protein | Toxin |
DKC2_RS09410 | 1954156..1954383 | - | 228 | WP_003408469.1 | antitoxin | Antitoxin |
DKC2_RS09415 | 1954601..1956085 | + | 1485 | WP_003408473.1 | carboxylase | - |
DKC2_RS09420 | 1956082..1957329 | + | 1248 | WP_003408476.1 | serine hydrolase | - |
DKC2_RS09425 | 1957372..1957791 | - | 420 | WP_003408483.1 | hypothetical protein | - |
DKC2_RS09430 | 1957781..1958491 | - | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T285950 WP_003408465.1 NZ_LR027516:c1954159-1953770 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7E4J | |
AlphaFold DB | A0A7U4FAN9 |