Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1700888..1701504 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | DKC2_RS08285 | Protein ID | WP_003407593.1 |
Coordinates | 1701187..1701504 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | DKC2_RS08280 | Protein ID | WP_003900349.1 |
Coordinates | 1700888..1701190 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS08270 | 1696774..1698621 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
DKC2_RS08275 | 1698622..1700874 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
DKC2_RS08280 | 1700888..1701190 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
DKC2_RS08285 | 1701187..1701504 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
DKC2_RS08290 | 1701501..1702505 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
DKC2_RS08295 | 1702558..1703847 | + | 1290 | WP_003407599.1 | serine hydrolase | - |
DKC2_RS08300 | 1703920..1704693 | - | 774 | WP_003911559.1 | class I SAM-dependent methyltransferase | - |
DKC2_RS08305 | 1704751..1704963 | - | 213 | WP_003898900.1 | dodecin family protein | - |
DKC2_RS21610 | 1704973..1705197 | - | 225 | WP_160522526.1 | NUDIX domain-containing protein | - |
DKC2_RS08315 | 1705467..1706495 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T285948 WP_003407593.1 NZ_LR027516:1701187-1701504 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|