Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1253513..1254081 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | DKC2_RS06195 | Protein ID | WP_003405865.1 |
Coordinates | 1253707..1254081 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | DKC2_RS06190 | Protein ID | WP_003405863.1 |
Coordinates | 1253513..1253710 (+) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS06170 | 1249554..1250192 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
DKC2_RS06175 | 1250282..1251289 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
DKC2_RS06180 | 1251306..1252289 | - | 984 | WP_003898731.1 | hypothetical protein | - |
DKC2_RS06185 | 1252352..1253425 | + | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
DKC2_RS06190 | 1253513..1253710 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
DKC2_RS06195 | 1253707..1254081 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DKC2_RS06200 | 1254284..1254982 | + | 699 | WP_003898733.1 | hypothetical protein | - |
DKC2_RS06205 | 1255100..1255285 | + | 186 | WP_003901093.1 | hypothetical protein | - |
DKC2_RS06210 | 1255212..1255487 | - | 276 | WP_003405867.1 | hypothetical protein | - |
DKC2_RS06215 | 1255730..1256053 | + | 324 | WP_003405871.1 | antibiotic biosynthesis monooxygenase | - |
DKC2_RS06220 | 1256068..1256778 | - | 711 | WP_003911399.1 | hypothetical protein | - |
DKC2_RS21840 | 1256800..1257009 | + | 210 | WP_003911400.1 | hypothetical protein | - |
DKC2_RS06225 | 1256961..1257668 | - | 708 | Protein_1178 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T285943 WP_003405865.1 NZ_LR027516:1253707-1254081 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|