Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1253513..1254081 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag DKC2_RS06195 Protein ID WP_003405865.1
Coordinates 1253707..1254081 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag DKC2_RS06190 Protein ID WP_003405863.1
Coordinates 1253513..1253710 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS06170 1249554..1250192 - 639 WP_003898730.1 lipid droplet-associated protein -
DKC2_RS06175 1250282..1251289 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
DKC2_RS06180 1251306..1252289 - 984 WP_003898731.1 hypothetical protein -
DKC2_RS06185 1252352..1253425 + 1074 WP_003898732.1 redox-regulated ATPase YchF -
DKC2_RS06190 1253513..1253710 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
DKC2_RS06195 1253707..1254081 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS06200 1254284..1254982 + 699 WP_003898733.1 hypothetical protein -
DKC2_RS06205 1255100..1255285 + 186 WP_003901093.1 hypothetical protein -
DKC2_RS06210 1255212..1255487 - 276 WP_003405867.1 hypothetical protein -
DKC2_RS06215 1255730..1256053 + 324 WP_003405871.1 antibiotic biosynthesis monooxygenase -
DKC2_RS06220 1256068..1256778 - 711 WP_003911399.1 hypothetical protein -
DKC2_RS21840 1256800..1257009 + 210 WP_003911400.1 hypothetical protein -
DKC2_RS06225 1256961..1257668 - 708 Protein_1178 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T285943 WP_003405865.1 NZ_LR027516:1253707-1254081 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT285943 WP_003405863.1 NZ_LR027516:1253513-1253710 [Mycobacterium tuberculosis]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References