Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1244757..1245388 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WIH8 |
Locus tag | DKC2_RS06140 | Protein ID | WP_003898728.1 |
Coordinates | 1244757..1245068 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | DKC2_RS06145 | Protein ID | WP_003405836.1 |
Coordinates | 1245068..1245388 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS06120 | 1240238..1241662 | - | 1425 | WP_030026248.1 | class II fumarate hydratase | - |
DKC2_RS06125 | 1241693..1242781 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
DKC2_RS06130 | 1242837..1243481 | + | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
DKC2_RS06135 | 1243488..1244645 | - | 1158 | WP_003898727.1 | AI-2E family transporter | - |
DKC2_RS06140 | 1244757..1245068 | - | 312 | WP_003898728.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
DKC2_RS06145 | 1245068..1245388 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
DKC2_RS06150 | 1245398..1246923 | + | 1526 | Protein_1162 | carboxylesterase/lipase family protein | - |
DKC2_RS06155 | 1246941..1248053 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
DKC2_RS06160 | 1248063..1248320 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
DKC2_RS06165 | 1248310..1249557 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
DKC2_RS06170 | 1249554..1250192 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11049.76 Da Isoelectric Point: 4.9371
>T285942 WP_003898728.1 NZ_LR027516:c1245068-1244757 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNTQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|