Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 853671..854380 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF74 |
Locus tag | DKC2_RS04150 | Protein ID | WP_003403837.1 |
Coordinates | 853952..854380 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TEX4 |
Locus tag | DKC2_RS04145 | Protein ID | WP_003403834.1 |
Coordinates | 853671..853928 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS04140 | 850782..853580 | + | 2799 | WP_138227945.1 | PE family protein | - |
DKC2_RS04145 | 853671..853928 | + | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
DKC2_RS04150 | 853952..854380 | + | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DKC2_RS04155 | 854470..854644 | - | 175 | Protein_795 | transposase | - |
DKC2_RS04160 | 854757..855002 | + | 246 | WP_003403841.1 | hypothetical protein | - |
DKC2_RS04165 | 855071..855955 | - | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
DKC2_RS04170 | 855966..857138 | - | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase FadE9 | - |
DKC2_RS04175 | 857145..858677 | - | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T285938 WP_003403837.1 NZ_LR027516:853952-854380 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CDR3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TEX4 |