Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 766866..767406 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P9WII0 |
Locus tag | DKC2_RS03635 | Protein ID | WP_003403376.1 |
Coordinates | 766866..767174 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | DKC2_RS03640 | Protein ID | WP_138227976.1 |
Coordinates | 767161..767406 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS03610 | 762181..763686 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
DKC2_RS03615 | 763767..764777 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
DKC2_RS03620 | 765165..765548 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
DKC2_RS03625 | 765643..765798 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
DKC2_RS03630 | 765874..766590 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
DKC2_RS03635 | 766866..767174 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DKC2_RS03640 | 767161..767406 | - | 246 | WP_138227976.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
DKC2_RS03645 | 767516..767953 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS03650 | 767950..768204 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
DKC2_RS03655 | 768318..770681 | + | 2364 | WP_003898547.1 | arylsulfatase AtsD | - |
DKC2_RS03660 | 770744..771070 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DKC2_RS03665 | 770982..771320 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
DKC2_RS03670 | 771317..771490 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T285935 WP_003403376.1 NZ_LR027516:c767174-766866 [Mycobacterium tuberculosis]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|