Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 765165..765798 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag DKC2_RS03620 Protein ID WP_003403365.1
Coordinates 765165..765548 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag DKC2_RS03625 Protein ID WP_003403368.1
Coordinates 765643..765798 (-) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS03595 760457..760993 + 537 WP_003403341.1 50S ribosomal protein L10 -
DKC2_RS03600 761030..761422 + 393 WP_003403353.1 50S ribosomal protein L7/L12 -
DKC2_RS03605 761415..762110 - 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
DKC2_RS03610 762181..763686 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
DKC2_RS03615 763767..764777 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
DKC2_RS03620 765165..765548 - 384 WP_003403365.1 ribonuclease VapC6 Toxin
DKC2_RS03625 765643..765798 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
DKC2_RS03630 765874..766590 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
DKC2_RS03635 766866..767174 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
DKC2_RS03640 767161..767406 - 246 WP_138227976.1 ribbon-helix-helix protein, CopG family -
DKC2_RS03645 767516..767953 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS03650 767950..768204 - 255 WP_003911263.1 antitoxin VapB7 -
DKC2_RS03655 768318..770681 + 2364 WP_003898547.1 arylsulfatase AtsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T285934 WP_003403365.1 NZ_LR027516:c765548-765165 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT285934 WP_003403368.1 NZ_LR027516:c765798-765643 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References