Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 728591..729240 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | DKC2_RS03435 | Protein ID | WP_003403236.1 |
Coordinates | 728845..729240 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | DKC2_RS03430 | Protein ID | WP_003403235.1 |
Coordinates | 728591..728845 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS21560 | 723717..724412 | + | 696 | WP_003900189.1 | galactose-1-phosphate uridylyltransferase | - |
DKC2_RS21565 | 724409..724900 | + | 492 | WP_012054156.1 | galactose-1-phosphate uridylyltransferase | - |
DKC2_RS03410 | 724897..725988 | + | 1092 | WP_003906403.1 | galactokinase | - |
DKC2_RS03420 | 726383..727447 | + | 1065 | WP_003898532.1 | hypothetical protein | - |
DKC2_RS03425 | 727551..728498 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
DKC2_RS03430 | 728591..728845 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
DKC2_RS03435 | 728845..729240 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
DKC2_RS03440 | 729334..730074 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
DKC2_RS03445 | 730206..730466 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
DKC2_RS03450 | 730463..730870 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
DKC2_RS03455 | 730942..732093 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
DKC2_RS03460 | 732186..733913 | - | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T285932 WP_003403236.1 NZ_LR027516:728845-729240 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ | |
AlphaFold DB | A0A7U4BSC2 |