Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 722963..723588 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | DKC2_RS03400 | Protein ID | WP_003403218.1 |
Coordinates | 723187..723588 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | DKC2_RS03395 | Protein ID | WP_003403213.1 |
Coordinates | 722963..723190 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS03365 | 718142..718363 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
DKC2_RS03370 | 718505..719110 | + | 606 | WP_003898526.1 | hypothetical protein | - |
DKC2_RS03375 | 719129..721696 | - | 2568 | WP_003900188.1 | SEC-C domain-containing protein | - |
DKC2_RS03380 | 721780..722529 | + | 750 | WP_003898528.1 | hypothetical protein | - |
DKC2_RS03385 | 722526..722768 | + | 243 | WP_003403210.1 | hypothetical protein | - |
DKC2_RS03395 | 722963..723190 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
DKC2_RS03400 | 723187..723588 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
DKC2_RS21560 | 723717..724412 | + | 696 | WP_003900189.1 | galactose-1-phosphate uridylyltransferase | - |
DKC2_RS21565 | 724409..724900 | + | 492 | WP_012054156.1 | galactose-1-phosphate uridylyltransferase | - |
DKC2_RS03410 | 724897..725988 | + | 1092 | WP_003906403.1 | galactokinase | - |
DKC2_RS03420 | 726383..727447 | + | 1065 | WP_003898532.1 | hypothetical protein | - |
DKC2_RS03425 | 727551..728498 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T285931 WP_003403218.1 NZ_LR027516:723187-723588 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |