Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 715425..716068 | Replicon | chromosome |
| Accession | NZ_LR027516 | ||
| Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P67239 |
| Locus tag | DKC2_RS03335 | Protein ID | WP_003403187.1 |
| Coordinates | 715667..716068 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ91 |
| Locus tag | DKC2_RS03330 | Protein ID | WP_003403184.1 |
| Coordinates | 715425..715670 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DKC2_RS03295 | 710705..711235 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| DKC2_RS03300 | 711219..711914 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| DKC2_RS03305 | 712037..712348 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| DKC2_RS03310 | 712420..713370 | + | 951 | WP_003900184.1 | DUF1259 domain-containing protein | - |
| DKC2_RS03315 | 713611..714195 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| DKC2_RS03320 | 714197..714907 | + | 711 | Protein_641 | transposase | - |
| DKC2_RS03325 | 714910..715380 | + | 471 | WP_003898523.1 | hypothetical protein | - |
| DKC2_RS03330 | 715425..715670 | + | 246 | WP_003403184.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| DKC2_RS03335 | 715667..716068 | + | 402 | WP_003403187.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DKC2_RS03350 | 716456..716623 | - | 168 | WP_077385191.1 | DUF3800 domain-containing protein | - |
| DKC2_RS03355 | 716656..716853 | - | 198 | WP_003403191.1 | hypothetical protein | - |
| DKC2_RS03360 | 716933..718090 | - | 1158 | WP_003898524.1 | hypothetical protein | - |
| DKC2_RS03365 | 718142..718363 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| DKC2_RS03370 | 718505..719110 | + | 606 | WP_003898526.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14501.21 Da Isoelectric Point: 4.4463
>T285930 WP_003403187.1 NZ_LR027516:715667-716068 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ91 |