Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 709335..709981 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag DKC2_RS03280 Protein ID WP_003403137.1
Coordinates 709335..709748 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag DKC2_RS03285 Protein ID WP_003403139.1
Coordinates 709745..709981 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS03260 705418..706968 + 1551 WP_003403119.1 MCE family protein -
DKC2_RS03265 707020..707412 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
DKC2_RS03270 707409..707666 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
DKC2_RS03275 707849..709084 - 1236 WP_003403128.1 ATP-binding protein -
DKC2_RS03280 709335..709748 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
DKC2_RS03285 709745..709981 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
DKC2_RS03290 710085..710591 - 507 WP_003900973.1 two component system sensor kinase HK1 -
DKC2_RS03295 710705..711235 - 531 WP_003917320.1 two component system sensor kinase HK2 -
DKC2_RS03300 711219..711914 - 696 WP_003918099.1 two-component system response regulator TcrA -
DKC2_RS03305 712037..712348 + 312 WP_003403164.1 hypothetical protein -
DKC2_RS03310 712420..713370 + 951 WP_003900184.1 DUF1259 domain-containing protein -
DKC2_RS03315 713611..714195 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
DKC2_RS03320 714197..714907 + 711 Protein_641 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T285929 WP_003403137.1 NZ_LR027516:c709748-709335 [Mycobacterium tuberculosis]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT285929 WP_003403139.1 NZ_LR027516:c709981-709745 [Mycobacterium tuberculosis]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References