Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 707020..707666 Replicon chromosome
Accession NZ_LR027516
Organism Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag DKC2_RS03265 Protein ID WP_003403122.1
Coordinates 707020..707412 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag DKC2_RS03270 Protein ID WP_003403125.1
Coordinates 707409..707666 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DKC2_RS03250 702682..704208 + 1527 WP_003403112.1 virulence factor Mce family protein -
DKC2_RS03255 704271..705413 + 1143 WP_003911253.1 virulence factor Mce family protein -
DKC2_RS03260 705418..706968 + 1551 WP_003403119.1 MCE family protein -
DKC2_RS03265 707020..707412 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
DKC2_RS03270 707409..707666 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
DKC2_RS03275 707849..709084 - 1236 WP_003403128.1 ATP-binding protein -
DKC2_RS03280 709335..709748 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
DKC2_RS03285 709745..709981 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
DKC2_RS03290 710085..710591 - 507 WP_003900973.1 two component system sensor kinase HK1 -
DKC2_RS03295 710705..711235 - 531 WP_003917320.1 two component system sensor kinase HK2 -
DKC2_RS03300 711219..711914 - 696 WP_003918099.1 two-component system response regulator TcrA -
DKC2_RS03305 712037..712348 + 312 WP_003403164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T285928 WP_003403122.1 NZ_LR027516:c707412-707020 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT285928 WP_003403125.1 NZ_LR027516:c707666-707409 [Mycobacterium tuberculosis]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References