Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
Location | 652418..653094 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPQ9 |
Locus tag | DKC2_RS03015 | Protein ID | WP_003898500.1 |
Coordinates | 652418..652831 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TPR0 |
Locus tag | DKC2_RS03020 | Protein ID | WP_003402915.1 |
Coordinates | 652828..653094 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS02985 | 647763..648065 | - | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
DKC2_RS02990 | 648125..648403 | - | 279 | WP_003402901.1 | hypothetical protein | - |
DKC2_RS02995 | 648400..649653 | - | 1254 | WP_003911224.1 | inorganic phosphate transporter family protein | - |
DKC2_RS03000 | 649773..650159 | - | 387 | WP_003402907.1 | VOC family protein | - |
DKC2_RS03005 | 650222..651106 | - | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
DKC2_RS03010 | 651202..652104 | - | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
DKC2_RS03015 | 652418..652831 | - | 414 | WP_003898500.1 | PIN domain-containing protein | Toxin |
DKC2_RS03020 | 652828..653094 | - | 267 | WP_003402915.1 | antitoxin VapB3 | Antitoxin |
DKC2_RS03025 | 653286..655001 | - | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
DKC2_RS03030 | 655079..656683 | + | 1605 | WP_003402920.1 | amidohydrolase | - |
DKC2_RS03035 | 656680..657660 | + | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T285926 WP_003898500.1 NZ_LR027516:c652831-652418 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|