Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 376041..376684 | Replicon | chromosome |
Accession | NZ_LR027516 | ||
Organism | Mycobacterium tuberculosis strain DKC2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB8 |
Locus tag | DKC2_RS01705 | Protein ID | WP_003401566.1 |
Coordinates | 376259..376684 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | DKC2_RS01700 | Protein ID | WP_003401563.1 |
Coordinates | 376041..376262 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DKC2_RS01675 | 371160..371963 | - | 804 | WP_003401540.1 | hypothetical protein | - |
DKC2_RS01680 | 371973..373370 | - | 1398 | WP_003401544.1 | sulfatase | - |
DKC2_RS01685 | 373549..375324 | + | 1776 | WP_010886074.1 | PE family protein | - |
DKC2_RS01690 | 375467..375694 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
DKC2_RS01695 | 375691..375993 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | - |
DKC2_RS01700 | 376041..376262 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
DKC2_RS01705 | 376259..376684 | + | 426 | WP_003401566.1 | PIN domain nuclease | Toxin |
DKC2_RS01710 | 376820..377452 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
DKC2_RS01715 | 377449..378357 | + | 909 | WP_003900117.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15713.90 Da Isoelectric Point: 5.6002
>T285924 WP_003401566.1 NZ_LR027516:376259-376684 [Mycobacterium tuberculosis]
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 3H87 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3H87 | |
AlphaFold DB | A0A829CG48 |