Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 3654861..3655544 | Replicon | chromosome |
Accession | NZ_LR026975 | ||
Organism | Mycolicibacterium hassiacum DSM 44199 isolate Mhassiacum |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | MHAS_RS17245 | Protein ID | WP_005629969.1 |
Coordinates | 3654861..3655298 (-) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | K5BAK9 |
Locus tag | MHAS_RS17250 | Protein ID | WP_005629971.1 |
Coordinates | 3655362..3655544 (-) | Length | 61 a.a. |
Genomic Context
Location: 3650225..3651475 (1251 bp)
Type: Others
Protein ID: WP_005629953.1
Type: Others
Protein ID: WP_005629953.1
Location: 3651472..3652515 (1044 bp)
Type: Others
Protein ID: WP_005629956.1
Type: Others
Protein ID: WP_005629956.1
Location: 3652512..3652925 (414 bp)
Type: Others
Protein ID: WP_018353909.1
Type: Others
Protein ID: WP_018353909.1
Location: 3652963..3654192 (1230 bp)
Type: Others
Protein ID: WP_005629963.1
Type: Others
Protein ID: WP_005629963.1
Location: 3654204..3654857 (654 bp)
Type: Others
Protein ID: WP_005629965.1
Type: Others
Protein ID: WP_005629965.1
Location: 3654861..3655298 (438 bp)
Type: Toxin
Protein ID: WP_005629969.1
Type: Toxin
Protein ID: WP_005629969.1
Location: 3655362..3655544 (183 bp)
Type: Antitoxin
Protein ID: WP_005629971.1
Type: Antitoxin
Protein ID: WP_005629971.1
Location: 3655550..3657958 (2409 bp)
Type: Others
Protein ID: WP_005629973.1
Type: Others
Protein ID: WP_005629973.1
Location: 3657955..3659508 (1554 bp)
Type: Others
Protein ID: WP_005629974.1
Type: Others
Protein ID: WP_005629974.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MHAS_RS17220 | 3650225..3651475 | + | 1251 | WP_005629953.1 | cytochrome P450 | - |
MHAS_RS17225 | 3651472..3652515 | + | 1044 | WP_005629956.1 | dihydrodipicolinate reductase | - |
MHAS_RS17230 | 3652512..3652925 | + | 414 | WP_018353909.1 | hypothetical protein | - |
MHAS_RS17235 | 3652963..3654192 | + | 1230 | WP_005629963.1 | cytochrome P450 | - |
MHAS_RS17240 | 3654204..3654857 | + | 654 | WP_005629965.1 | isomerase | - |
MHAS_RS17245 | 3654861..3655298 | - | 438 | WP_005629969.1 | SRPBCC family protein | Toxin |
MHAS_RS17250 | 3655362..3655544 | - | 183 | WP_005629971.1 | antitoxin | Antitoxin |
MHAS_RS17255 | 3655550..3657958 | - | 2409 | WP_005629973.1 | cation-translocating P-type ATPase | - |
MHAS_RS17260 | 3657955..3659508 | - | 1554 | WP_005629974.1 | serine hydrolase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15981.70 Da Isoelectric Point: 10.1340
>T285920 WP_005629969.1 NZ_LR026975:c3655298-3654861 [Mycolicibacterium hassiacum DSM 44199]
MAKLSVSVDVPLPPEKAWECASDLSRYHEWLSIHRVWRSKLPETIEKGTVVESIVEVKGMLNRIRWKIVHYKPPEAMTLN
GDGVGGVKVKLIGKIRPSGEGSTVQFDIHLGGPALFGPIGMLVAAALRSDIQQSLNQFKRVFAPA
MAKLSVSVDVPLPPEKAWECASDLSRYHEWLSIHRVWRSKLPETIEKGTVVESIVEVKGMLNRIRWKIVHYKPPEAMTLN
GDGVGGVKVKLIGKIRPSGEGSTVQFDIHLGGPALFGPIGMLVAAALRSDIQQSLNQFKRVFAPA
Download Length: 438 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | K5BAK9 |