Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 8388..8980 Replicon plasmid 4
Accession NZ_LR025103
Organism Escherichia coli isolate EC-1639

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag EC1639_RS25150 Protein ID WP_000520549.1
Coordinates 8388..8636 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag EC1639_RS25155 Protein ID WP_000681613.1
Coordinates 8633..8980 (+) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1639_RS25115 5364..5879 + 516 WP_001025395.1 J domain-containing protein -
EC1639_RS25120 5984..6526 + 543 WP_001083906.1 hypothetical protein -
EC1639_RS25125 6523..6774 + 252 WP_001230707.1 hypothetical protein -
EC1639_RS25130 6761..6988 + 228 WP_000801440.1 hypothetical protein -
EC1639_RS25135 7083..7435 + 353 Protein_11 molecular chaperone DnaJ -
EC1639_RS25140 7437..7709 + 273 WP_001272373.1 hypothetical protein -
EC1639_RS25145 7777..8082 + 306 WP_072182957.1 hypothetical protein -
EC1639_RS25150 8388..8636 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
EC1639_RS25155 8633..8980 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EC1639_RS25165 9341..9841 + 501 WP_063270188.1 hypothetical protein -
EC1639_RS25170 9853..11082 + 1230 WP_001694183.1 relaxase/mobilization nuclease domain-containing protein -
EC1639_RS25175 11159..11425 + 267 WP_000160396.1 hypothetical protein -
EC1639_RS25180 11430..11663 + 234 WP_134051832.1 EexN family lipoprotein -
EC1639_RS25185 12027..12647 + 621 WP_001694184.1 lytic transglycosylase domain-containing protein -
EC1639_RS25190 12715..12987 + 273 WP_032143906.1 TrbC/VirB2 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..31016 31016


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T285919 WP_000520549.1 NZ_LR025103:8388-8636 [Escherichia coli]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT285919 WP_000681613.1 NZ_LR025103:8633-8980 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References