Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 84675..85200 | Replicon | plasmid 2 |
Accession | NZ_LR025102 | ||
Organism | Escherichia coli isolate EC-1639 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | EC1639_RS25020 | Protein ID | WP_001159868.1 |
Coordinates | 84675..84980 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | EC1639_RS25025 | Protein ID | WP_000813634.1 |
Coordinates | 84982..85200 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1639_RS25005 | 80585..81751 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
EC1639_RS25010 | 82339..83094 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
EC1639_RS25015 | 83868..84674 | - | 807 | WP_000016982.1 | site-specific integrase | - |
EC1639_RS25020 | 84675..84980 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
EC1639_RS25025 | 84982..85200 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
EC1639_RS25030 | 85908..86903 | + | 996 | WP_000246635.1 | hypothetical protein | - |
EC1639_RS25035 | 86907..87839 | + | 933 | WP_000991831.1 | hypothetical protein | - |
EC1639_RS25040 | 88132..88317 | + | 186 | WP_001586223.1 | hypothetical protein | - |
EC1639_RS25045 | 88318..89220 | + | 903 | WP_024187432.1 | hypothetical protein | - |
EC1639_RS25050 | 89222..89956 | + | 735 | Protein_105 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aadA5 / qacE / sul1 / mph(A) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..94720 | 94720 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T285917 WP_001159868.1 NZ_LR025102:c84980-84675 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|