Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 49631..50190 Replicon plasmid 2
Accession NZ_LR025102
Organism Escherichia coli isolate EC-1639

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag EC1639_RS24775 Protein ID WP_000421272.1
Coordinates 49915..50190 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag EC1639_RS24770 Protein ID WP_001387467.1
Coordinates 49631..49915 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1639_RS24740 45094..45534 - 441 Protein_54 zinc-binding dehydrogenase -
EC1639_RS24750 45935..46825 + 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
EC1639_RS24755 46850..47230 + 381 WP_000710783.1 Rid family detoxifying hydrolase -
EC1639_RS24760 47263..48228 + 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
EC1639_RS24765 48274..49026 - 753 WP_134051825.1 IclR family transcriptional regulator -
EC1639_RS24770 49631..49915 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
EC1639_RS24775 49915..50190 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EC1639_RS24780 50253..50950 - 698 Protein_61 IS1 family transposase -
EC1639_RS24795 51295..51999 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
EC1639_RS24800 52063..52401 + 339 Protein_63 recombinase family protein -
EC1639_RS24805 52584..53444 + 861 WP_000027057.1 class A broad-spectrum beta-lactamase TEM-1 -
EC1639_RS24810 53591..53872 + 282 Protein_65 transposase zinc-binding domain-containing protein -
EC1639_RS24820 54042..54746 + 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA5 / qacE / sul1 / mph(A) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id - 1..94720 94720


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T285916 WP_000421272.1 NZ_LR025102:49915-50190 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT285916 WP_001387467.1 NZ_LR025102:49631-49915 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References