Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6039..6633 Replicon plasmid 2
Accession NZ_LR025102
Organism Escherichia coli isolate EC-1639

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag EC1639_RS24460 Protein ID WP_001403920.1
Coordinates 6358..6633 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID G3CAJ1
Locus tag EC1639_RS24455 Protein ID WP_001261274.1
Coordinates 6039..6269 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1639_RS25980 1542..2314 - 773 Protein_2 hypothetical protein -
EC1639_RS24445 2343..2828 - 486 WP_001403958.1 hypothetical protein -
EC1639_RS24450 3219..5840 + 2622 WP_001586230.1 hypothetical protein -
EC1639_RS24455 6039..6269 + 231 WP_001261274.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EC1639_RS24460 6358..6633 + 276 WP_001403920.1 type II toxin-antitoxin system VapC family toxin Toxin
EC1639_RS24465 6638..6855 - 218 Protein_7 transposase -
EC1639_RS24470 6856..7386 - 531 WP_000348883.1 GNAT family N-acetyltransferase -
EC1639_RS24475 7390..7659 - 270 WP_001275013.1 DUF1778 domain-containing protein -
EC1639_RS24480 8547..9536 + 990 WP_123002471.1 RepB family plasmid replication initiator protein -
EC1639_RS24485 9859..10599 - 741 WP_001586233.1 tyrosine-type recombinase/integrase -
EC1639_RS24490 10720..10902 - 183 WP_042004909.1 hypothetical protein -
EC1639_RS24500 11245..11552 - 308 Protein_13 type II toxin-antitoxin system ParD family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aadA5 / qacE / sul1 / mph(A) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id - 1..94720 94720


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

SpoVT-AbrB domain

(7-45)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 9621.03 Da        Isoelectric Point: 8.5444

>T285914 WP_001403920.1 NZ_LR025102:6358-6633 [Escherichia coli]
VFSHRIVVSAITYSEMRFGASGPKASPRHVQLVDKFCPCLDAILSWDRAAVDGTTDIKVALRQAGTPIGQNDTAIAGPEA
GRLGKLTSPTL

Download         Length: 276 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8856.95 Da        Isoelectric Point: 4.6286

>AT285914 WP_001261274.1 NZ_LR025102:6039-6269 [Escherichia coli]
MRTVSIFKNGNNRAIHLPRDLDFERVRELEIVREGDSIILRPVQPNWGSFAQLEKADPDFMAERENVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB G3CAJ1

References