Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2455749..2456387 | Replicon | chromosome |
| Accession | NZ_LR025101 | ||
| Organism | Escherichia coli isolate EC-1639 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | D3GRG9 |
| Locus tag | EC1639_RS11930 | Protein ID | WP_001314712.1 |
| Coordinates | 2455749..2455925 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EC1639_RS11935 | Protein ID | WP_077248684.1 |
| Coordinates | 2455971..2456387 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1639_RS11910 | 2451371..2452582 | - | 1212 | WP_071593600.1 | BenE family transporter YdcO | - |
| EC1639_RS11915 | 2452635..2453171 | + | 537 | WP_000429149.1 | DNA-binding transcriptional regulator SutR | - |
| EC1639_RS11920 | 2453244..2455205 | + | 1962 | WP_001587031.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EC1639_RS11925 | 2455297..2455527 | - | 231 | WP_000494241.1 | YncJ family protein | - |
| EC1639_RS11930 | 2455749..2455925 | + | 177 | WP_001314712.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EC1639_RS11935 | 2455971..2456387 | + | 417 | WP_077248684.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EC1639_RS11940 | 2456466..2457872 | + | 1407 | WP_000760623.1 | PLP-dependent aminotransferase family protein | - |
| EC1639_RS11945 | 2458117..2459262 | + | 1146 | WP_000047443.1 | ABC transporter substrate-binding protein | - |
| EC1639_RS11950 | 2459280..2460293 | + | 1014 | WP_000220407.1 | ABC transporter ATP-binding protein | - |
| EC1639_RS11955 | 2460294..2461235 | + | 942 | WP_001587036.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6746.81 Da Isoelectric Point: 11.8888
>T285901 WP_001314712.1 NZ_LR025101:2455749-2455925 [Escherichia coli]
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVNVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15232.60 Da Isoelectric Point: 4.7286
>AT285901 WP_077248684.1 NZ_LR025101:2455971-2456387 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSDITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|