Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 1778289..1778994 | Replicon | chromosome |
Accession | NZ_LR025101 | ||
Organism | Escherichia coli isolate EC-1639 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | EC1639_RS08375 | Protein ID | WP_000539521.1 |
Coordinates | 1778608..1778994 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EC1639_RS08370 | Protein ID | WP_001280945.1 |
Coordinates | 1778289..1778618 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC1639_RS08355 | 1773446..1774357 | + | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
EC1639_RS08360 | 1774535..1776883 | + | 2349 | WP_001305945.1 | EAL domain-containing protein | - |
EC1639_RS08365 | 1776891..1778219 | + | 1329 | WP_001586846.1 | GGDEF domain-containing protein | - |
EC1639_RS08370 | 1778289..1778618 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
EC1639_RS08375 | 1778608..1778994 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EC1639_RS08380 | 1779220..1780545 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
EC1639_RS08385 | 1780758..1781141 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
EC1639_RS08390 | 1781252..1782367 | + | 1116 | WP_000555033.1 | aldose sugar dehydrogenase YliI | - |
EC1639_RS08395 | 1782364..1782990 | - | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T285892 WP_000539521.1 NZ_LR025101:c1778994-1778608 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|