Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1323720..1324338 | Replicon | chromosome |
| Accession | NZ_LR025101 | ||
| Organism | Escherichia coli isolate EC-1639 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EC1639_RS06215 | Protein ID | WP_001291435.1 |
| Coordinates | 1323720..1323938 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EC1639_RS06220 | Protein ID | WP_000344800.1 |
| Coordinates | 1323964..1324338 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1639_RS06180 | 1319009..1319581 | + | 573 | WP_000779833.1 | YbaY family lipoprotein | - |
| EC1639_RS06185 | 1319612..1319923 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| EC1639_RS06195 | 1320302..1320655 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| EC1639_RS06200 | 1320697..1322247 | - | 1551 | WP_001305493.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EC1639_RS06205 | 1322411..1322881 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| EC1639_RS06210 | 1322997..1323548 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| EC1639_RS06215 | 1323720..1323938 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EC1639_RS06220 | 1323964..1324338 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EC1639_RS06225 | 1324884..1328033 | - | 3150 | WP_001132480.1 | multidrug efflux RND transporter permease subunit | - |
| EC1639_RS06230 | 1328056..1329249 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T285891 WP_001291435.1 NZ_LR025101:c1323938-1323720 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285891 WP_000344800.1 NZ_LR025101:c1324338-1323964 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |