Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 863615..864039 Replicon chromosome
Accession NZ_LR025101
Organism Escherichia coli isolate EC-1639

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag EC1639_RS25870 Protein ID WP_001586653.1
Coordinates 863851..864039 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag EC1639_RS04100 Protein ID WP_000125566.1
Coordinates 863615..863848 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1639_RS04075 858688..858975 + 288 WP_000203747.1 ferredoxin-like protein FixX -
EC1639_RS04080 859034..860365 + 1332 WP_001183198.1 MFS transporter -
EC1639_RS04085 860473..861003 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
EC1639_RS04090 860996..862858 + 1863 WP_000377113.1 glutathione-regulated potassium-efflux system protein KefC -
EC1639_RS04095 863050..863529 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
EC1639_RS04100 863615..863848 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
EC1639_RS25870 863851..864039 + 189 WP_001586653.1 CcdB family protein Toxin
EC1639_RS25875 864036..864152 + 117 WP_001389634.1 CcdB family protein -
EC1639_RS04110 864149..864997 - 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
EC1639_RS04115 865004..865381 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
EC1639_RS04120 865384..866205 - 822 WP_001065361.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
EC1639_RS04125 866202..867191 - 990 WP_000241280.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
EC1639_RS04130 867191..868477 - 1287 WP_000800470.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-57)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7029.22 Da        Isoelectric Point: 8.7938

>T285888 WP_001586653.1 NZ_LR025101:863851-864039 [Escherichia coli]
MQFTVYRSRGSNAAFPFVIDVTSDIIGEINRSIVIPLTPIERFIRIRPPERLNTILLLVDGS

Download         Length: 189 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT285888 WP_000125566.1 NZ_LR025101:863615-863848 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References