Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 585614..586209 | Replicon | chromosome |
| Accession | NZ_LR025101 | ||
| Organism | Escherichia coli isolate EC-1639 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | EC1639_RS02735 | Protein ID | WP_000239581.1 |
| Coordinates | 585859..586209 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | EC1639_RS02730 | Protein ID | WP_001223213.1 |
| Coordinates | 585614..585865 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC1639_RS02720 | 581279..585058 | + | 3780 | WP_001586589.1 | autotransporter assembly complex protein TamB | - |
| EC1639_RS02725 | 585061..585402 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| EC1639_RS02730 | 585614..585865 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| EC1639_RS02735 | 585859..586209 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| EC1639_RS02740 | 586288..586818 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| EC1639_RS02745 | 587128..588084 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| EC1639_RS02750 | 588224..589726 | + | 1503 | WP_000210560.1 | sugar ABC transporter ATP-binding protein | - |
| EC1639_RS02755 | 589740..590762 | + | 1023 | WP_001586590.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T285884 WP_000239581.1 NZ_LR025101:585859-586209 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|