Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4506363..4507020 | Replicon | chromosome |
| Accession | NZ_LR025099 | ||
| Organism | Klebsiella pneumoniae isolate EC-12536 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | EC12536_RS22315 | Protein ID | WP_002916310.1 |
| Coordinates | 4506363..4506773 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | EC12536_RS22320 | Protein ID | WP_002916312.1 |
| Coordinates | 4506754..4507020 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC12536_RS22295 | 4502363..4504096 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EC12536_RS22300 | 4504102..4504815 | - | 714 | WP_004185548.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EC12536_RS22305 | 4504838..4505734 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| EC12536_RS22310 | 4505835..4506356 | + | 522 | WP_004144730.1 | flavodoxin FldB | - |
| EC12536_RS22315 | 4506363..4506773 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| EC12536_RS22320 | 4506754..4507020 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| EC12536_RS22325 | 4507266..4508249 | + | 984 | WP_004185555.1 | tRNA-modifying protein YgfZ | - |
| EC12536_RS22330 | 4508400..4509059 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
| EC12536_RS22335 | 4509223..4509534 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| EC12536_RS22340 | 4509584..4510312 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| EC12536_RS22345 | 4510431..4511864 | + | 1434 | WP_004174453.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T285881 WP_002916310.1 NZ_LR025099:c4506773-4506363 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |