Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1300023..1300642 Replicon chromosome
Accession NZ_LR025099
Organism Klebsiella pneumoniae isolate EC-12536

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag EC12536_RS06345 Protein ID WP_002892050.1
Coordinates 1300023..1300241 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag EC12536_RS06350 Protein ID WP_002892066.1
Coordinates 1300268..1300642 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC12536_RS06315 1296066..1296329 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
EC12536_RS06320 1296329..1296469 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
EC12536_RS06325 1296466..1297164 - 699 WP_002892021.1 GNAT family N-acetyltransferase -
EC12536_RS06330 1297265..1298716 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
EC12536_RS06335 1298691..1299161 - 471 WP_002892026.1 YlaC family protein -
EC12536_RS27020 1299182..1299322 + 141 WP_004147370.1 hypothetical protein -
EC12536_RS06340 1299294..1299860 - 567 WP_002892030.1 maltose O-acetyltransferase -
EC12536_RS06345 1300023..1300241 - 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
EC12536_RS06350 1300268..1300642 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
EC12536_RS06355 1301128..1304274 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
EC12536_RS06360 1304297..1305490 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T285875 WP_002892050.1 NZ_LR025099:c1300241-1300023 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT285875 WP_002892066.1 NZ_LR025099:c1300642-1300268 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References