Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 593770..594286 | Replicon | chromosome |
| Accession | NZ_LR025099 | ||
| Organism | Klebsiella pneumoniae isolate EC-12536 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | EC12536_RS02935 | Protein ID | WP_002886902.1 |
| Coordinates | 594002..594286 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | EC12536_RS02930 | Protein ID | WP_002886901.1 |
| Coordinates | 593770..594012 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC12536_RS02915 | 589798..590538 | + | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
| EC12536_RS02920 | 590605..591759 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| EC12536_RS02925 | 591782..593692 | + | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| EC12536_RS02930 | 593770..594012 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EC12536_RS02935 | 594002..594286 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EC12536_RS02940 | 594290..594754 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| EC12536_RS02945 | 594995..597133 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| EC12536_RS02950 | 597490..598233 | - | 744 | WP_040188479.1 | MurR/RpiR family transcriptional regulator | - |
| EC12536_RS26950 | 598236..598409 | - | 174 | WP_002886906.1 | hypothetical protein | - |
| EC12536_RS02955 | 598494..598802 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T285873 WP_002886902.1 NZ_LR025099:594002-594286 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |