Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 78800..79425 | Replicon | chromosome |
| Accession | NZ_LR025099 | ||
| Organism | Klebsiella pneumoniae isolate EC-12536 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | EC12536_RS00390 | Protein ID | WP_002882817.1 |
| Coordinates | 79042..79425 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EC12536_RS00385 | Protein ID | WP_172601897.1 |
| Coordinates | 78800..79042 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC12536_RS00360 | 74791..75390 | + | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
| EC12536_RS00365 | 75384..76244 | + | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| EC12536_RS00370 | 76241..76678 | + | 438 | WP_002882809.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| EC12536_RS00375 | 76723..77664 | + | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| EC12536_RS00380 | 77678..78595 | - | 918 | WP_004178029.1 | alpha/beta hydrolase | - |
| EC12536_RS00385 | 78800..79042 | + | 243 | WP_172601897.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| EC12536_RS00390 | 79042..79425 | + | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EC12536_RS00395 | 79599..80528 | - | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| EC12536_RS00400 | 80525..81160 | - | 636 | WP_134155443.1 | formate dehydrogenase cytochrome b556 subunit | - |
| EC12536_RS00405 | 81157..82059 | - | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T285871 WP_002882817.1 NZ_LR025099:79042-79425 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|