Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 38660..39285 | Replicon | plasmid 2 |
| Accession | NZ_LR025097 | ||
| Organism | Escherichia coli isolate EC-7215 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EC7215_RS23710 | Protein ID | WP_000911324.1 |
| Coordinates | 38660..39058 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | EC7215_RS23715 | Protein ID | WP_000450532.1 |
| Coordinates | 39058..39285 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC7215_RS23695 | 34968..35489 | + | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
| EC7215_RS23700 | 35514..36245 | + | 732 | WP_000850422.1 | complement resistance protein TraT | - |
| EC7215_RS23705 | 36498..38651 | + | 2154 | WP_000009350.1 | type IV conjugative transfer system coupling protein TraD | - |
| EC7215_RS23710 | 38660..39058 | - | 399 | WP_000911324.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| EC7215_RS23715 | 39058..39285 | - | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 / mph(A) / blaTEM-1B / aadA2 / sul3 / ant(3'')-Ia / aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / floR / tet(A) / sitABCD | iroN / iroE / iroD / iroC / iroB | 1..142200 | 142200 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14800.09 Da Isoelectric Point: 7.8604
>T285869 WP_000911324.1 NZ_LR025097:c39058-38660 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELALQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|