Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4783993..4784660 | Replicon | chromosome |
| Accession | NZ_LR025096 | ||
| Organism | Escherichia coli isolate EC-7215 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | E1IS66 |
| Locus tag | EC7215_RS23195 | Protein ID | WP_000856973.1 |
| Coordinates | 4784340..4784660 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | E1IS67 |
| Locus tag | EC7215_RS23190 | Protein ID | WP_000052843.1 |
| Coordinates | 4783993..4784319 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC7215_RS23160 | 4779505..4780194 | + | 690 | WP_000115588.1 | WYL domain-containing protein | - |
| EC7215_RS23165 | 4780256..4781266 | + | 1011 | WP_001348677.1 | hypothetical protein | - |
| EC7215_RS23175 | 4781505..4782682 | + | 1178 | WP_085968792.1 | IS3 family transposase | - |
| EC7215_RS23180 | 4782704..4783441 | + | 738 | Protein_4456 | DUF932 domain-containing protein | - |
| EC7215_RS23185 | 4783510..4783980 | + | 471 | WP_001275770.1 | DNA repair protein RadC | - |
| EC7215_RS23190 | 4783993..4784319 | + | 327 | WP_000052843.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EC7215_RS23195 | 4784340..4784660 | + | 321 | WP_000856973.1 | TA system toxin CbtA family protein | Toxin |
| EC7215_RS23205 | 4785427..4786611 | + | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| EC7215_RS23210 | 4786722..4787645 | + | 924 | WP_000535971.1 | carboxylate/amino acid/amine transporter | - |
| EC7215_RS23215 | 4787649..4788467 | - | 819 | WP_000779426.1 | lipoprotein NlpA | - |
| EC7215_RS23220 | 4788689..4788982 | + | 294 | WP_000805509.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12080.87 Da Isoelectric Point: 5.5873
>T285865 WP_000856973.1 NZ_LR025096:4784340-4784660 [Escherichia coli]
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
MKTQPATTPQAAKPCLSPLAVWQMLLTSLLDQHYGLTLNDTPFSDETVIQKHIEAGITLADAVNFLVERYELVRIDQKGF
SVQDQEPWLTSMDVHRARFKLNVERL
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345ENE3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A345ENE4 |