Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3957572..3958226 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | EC7215_RS19125 | Protein ID | WP_000244772.1 |
Coordinates | 3957572..3957979 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | EC7215_RS19130 | Protein ID | WP_000354046.1 |
Coordinates | 3957960..3958226 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS19105 | 3953529..3955262 | - | 1734 | WP_000813220.1 | single-stranded-DNA-specific exonuclease RecJ | - |
EC7215_RS19110 | 3955268..3955978 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
EC7215_RS19115 | 3956003..3956899 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
EC7215_RS19120 | 3957011..3957532 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
EC7215_RS19125 | 3957572..3957979 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
EC7215_RS19130 | 3957960..3958226 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
EC7215_RS19135 | 3958469..3959449 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
EC7215_RS19145 | 3959702..3960682 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
EC7215_RS19150 | 3960805..3961464 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
EC7215_RS19155 | 3961628..3961939 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3959702..3960682 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T285863 WP_000244772.1 NZ_LR025096:c3957979-3957572 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |