Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3783584..3784167 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | EC7215_RS18320 | Protein ID | WP_000254745.1 |
Coordinates | 3783584..3783919 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | EC7215_RS18325 | Protein ID | WP_000581937.1 |
Coordinates | 3783919..3784167 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS18300 | 3779053..3779415 | + | 363 | WP_000034928.1 | hypothetical protein | - |
EC7215_RS18305 | 3779471..3780769 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
EC7215_RS18310 | 3780857..3782494 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
EC7215_RS18315 | 3782722..3783513 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
EC7215_RS18320 | 3783584..3783919 | - | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
EC7215_RS18325 | 3783919..3784167 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
EC7215_RS18330 | 3784245..3786479 | - | 2235 | WP_027662018.1 | GTP diphosphokinase | - |
EC7215_RS18335 | 3786527..3787828 | - | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | vipA/tssB / vipB/tssC / hcp/tssD / clpV/tssH / tssF | 3776652..3898428 | 121776 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T285862 WP_000254745.1 NZ_LR025096:c3783919-3783584 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |