Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3500776..3501401 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | EC7215_RS16930 | Protein ID | WP_000911329.1 |
Coordinates | 3500776..3501174 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | EC7215_RS16935 | Protein ID | WP_000450524.1 |
Coordinates | 3501174..3501401 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS16910 | 3496654..3496854 | + | 201 | WP_000383836.1 | YpfN family protein | - |
EC7215_RS16915 | 3496964..3497662 | - | 699 | WP_000679812.1 | esterase | - |
EC7215_RS16920 | 3497736..3499751 | - | 2016 | WP_000829332.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
EC7215_RS16925 | 3499766..3500629 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
EC7215_RS16930 | 3500776..3501174 | - | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
EC7215_RS16935 | 3501174..3501401 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
EC7215_RS16940 | 3501557..3502270 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
EC7215_RS16945 | 3502483..3503517 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
EC7215_RS16950 | 3503534..3504412 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
EC7215_RS16955 | 3504558..3505130 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
EC7215_RS16960 | 3505130..3505600 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T285861 WP_000911329.1 NZ_LR025096:c3501174-3500776 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |