Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2965053..2965884 | Replicon | chromosome |
| Accession | NZ_LR025096 | ||
| Organism | Escherichia coli isolate EC-7215 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | EC7215_RS14435 | Protein ID | WP_000854814.1 |
| Coordinates | 2965510..2965884 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | EC7215_RS14430 | Protein ID | WP_001285585.1 |
| Coordinates | 2965053..2965421 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC7215_RS14395 | 2961957..2962412 | + | 456 | WP_000581504.1 | hypothetical protein | - |
| EC7215_RS14400 | 2962491..2962724 | + | 234 | WP_001119729.1 | DUF905 family protein | - |
| EC7215_RS14410 | 2962824..2963642 | + | 819 | WP_001234629.1 | DUF945 domain-containing protein | - |
| EC7215_RS14415 | 2963724..2964203 | + | 480 | WP_000860087.1 | antirestriction protein | - |
| EC7215_RS14420 | 2964219..2964695 | + | 477 | WP_001186746.1 | RadC family protein | - |
| EC7215_RS14425 | 2964758..2964979 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| EC7215_RS14430 | 2965053..2965421 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| EC7215_RS14435 | 2965510..2965884 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| EC7215_RS14440 | 2965881..2966075 | + | 195 | WP_000988600.1 | hypothetical protein | - |
| EC7215_RS14445 | 2966088..2966201 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| EC7215_RS14450 | 2966490..2966618 | - | 129 | Protein_2764 | transposase domain-containing protein | - |
| EC7215_RS14455 | 2966690..2966872 | + | 183 | WP_001016348.1 | hypothetical protein | - |
| EC7215_RS14460 | 2966973..2967302 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| EC7215_RS14465 | 2967474..2968532 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| EC7215_RS14470 | 2968730..2969203 | - | 474 | WP_001105389.1 | DNA gyrase inhibitor SbmC | - |
| EC7215_RS14475 | 2969322..2970488 | - | 1167 | WP_000830150.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T285860 WP_000854814.1 NZ_LR025096:2965510-2965884 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT285860 WP_001285585.1 NZ_LR025096:2965053-2965421 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |