Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2329103..2329741 | Replicon | chromosome |
| Accession | NZ_LR025096 | ||
| Organism | Escherichia coli isolate EC-7215 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | EC7215_RS11220 | Protein ID | WP_000813794.1 |
| Coordinates | 2329103..2329279 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EC7215_RS11225 | Protein ID | WP_001270286.1 |
| Coordinates | 2329325..2329741 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC7215_RS11200 | 2324722..2325936 | - | 1215 | WP_001307190.1 | BenE family transporter YdcO | - |
| EC7215_RS11205 | 2325989..2326525 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| EC7215_RS11210 | 2326598..2328559 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| EC7215_RS11215 | 2328651..2328881 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| EC7215_RS11220 | 2329103..2329279 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| EC7215_RS11225 | 2329325..2329741 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| EC7215_RS11230 | 2329820..2331226 | + | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
| EC7215_RS11235 | 2331471..2332616 | + | 1146 | WP_000047455.1 | ABC transporter substrate-binding protein | - |
| EC7215_RS11240 | 2332634..2333647 | + | 1014 | WP_000220416.1 | ABC transporter ATP-binding protein | - |
| EC7215_RS11245 | 2333648..2334589 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2323417..2324682 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T285855 WP_000813794.1 NZ_LR025096:2329103-2329279 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT285855 WP_001270286.1 NZ_LR025096:2329325-2329741 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|