Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1283619..1284237 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | EC7215_RS06040 | Protein ID | WP_001291435.1 |
Coordinates | 1283619..1283837 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | EC7215_RS06045 | Protein ID | WP_000344800.1 |
Coordinates | 1283863..1284237 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS06005 | 1278908..1279480 | + | 573 | WP_000779839.1 | YbaY family lipoprotein | - |
EC7215_RS06010 | 1279511..1279822 | - | 312 | WP_000409911.1 | MGMT family protein | - |
EC7215_RS06020 | 1280201..1280554 | + | 354 | WP_000878141.1 | DUF1428 family protein | - |
EC7215_RS06025 | 1280596..1282146 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
EC7215_RS06030 | 1282310..1282780 | - | 471 | WP_000136192.1 | YlaC family protein | - |
EC7215_RS06035 | 1282896..1283447 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
EC7215_RS06040 | 1283619..1283837 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
EC7215_RS06045 | 1283863..1284237 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
EC7215_RS06050 | 1284783..1287932 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
EC7215_RS06055 | 1287955..1289148 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T285854 WP_001291435.1 NZ_LR025096:c1283837-1283619 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT285854 WP_000344800.1 NZ_LR025096:c1284237-1283863 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |