Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1249321..1250158 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | EC7215_RS05870 | Protein ID | WP_000227784.1 |
Coordinates | 1249321..1249863 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | EC7215_RS05875 | Protein ID | WP_001297137.1 |
Coordinates | 1249847..1250158 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS05850 | 1244860..1245771 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
EC7215_RS05855 | 1245939..1246430 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
EC7215_RS05860 | 1246558..1247922 | - | 1365 | WP_001000978.1 | MFS transporter | - |
EC7215_RS05865 | 1248330..1249265 | + | 936 | WP_001297127.1 | sel1 repeat family protein | - |
EC7215_RS05870 | 1249321..1249863 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
EC7215_RS05875 | 1249847..1250158 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
EC7215_RS05880 | 1250343..1251233 | - | 891 | WP_000971336.1 | heme o synthase | - |
EC7215_RS05885 | 1251245..1251574 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
EC7215_RS05890 | 1251574..1252188 | - | 615 | WP_000179814.1 | cytochrome o ubiquinol oxidase subunit III | - |
EC7215_RS05895 | 1252178..1254169 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
EC7215_RS05900 | 1254191..1255138 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T285853 WP_000227784.1 NZ_LR025096:c1249863-1249321 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|