Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 673699..674519 | Replicon | chromosome |
Accession | NZ_LR025096 | ||
Organism | Escherichia coli isolate EC-7215 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | B6I030 |
Locus tag | EC7215_RS03225 | Protein ID | WP_001054379.1 |
Coordinates | 674262..674519 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | EC7215_RS03220 | Protein ID | WP_000123957.1 |
Coordinates | 673699..674250 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EC7215_RS03195 | 669393..670706 | - | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
EC7215_RS03200 | 670718..670996 | - | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
EC7215_RS03205 | 670993..672114 | - | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
EC7215_RS24905 | 672359..672475 | - | 117 | Protein_600 | VOC family protein | - |
EC7215_RS03210 | 672513..672773 | - | 261 | WP_000077646.1 | hypothetical protein | - |
EC7215_RS03215 | 672901..673647 | - | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
EC7215_RS03220 | 673699..674250 | - | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
EC7215_RS03225 | 674262..674519 | - | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
EC7215_RS03230 | 674896..675195 | - | 300 | WP_001332034.1 | GNAT family N-acetyltransferase | - |
EC7215_RS03235 | 675273..676499 | + | 1227 | Protein_606 | helicase YjhR | - |
EC7215_RS03240 | 677082..678062 | - | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
EC7215_RS03245 | 678126..679232 | - | 1107 | WP_001295733.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T285851 WP_001054379.1 NZ_LR025096:c674519-674262 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT285851 WP_000123957.1 NZ_LR025096:c674250-673699 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|