Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 156834..157570 Replicon plasmid 2
Accession NZ_LR025093
Organism Klebsiella pneumoniae isolate KP9201

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag KP920_RS27130 Protein ID WP_003026803.1
Coordinates 157088..157570 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag KP920_RS27125 Protein ID WP_003026799.1
Coordinates 156834..157100 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP920_RS27080 152896..153258 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
KP920_RS27085 153308..153658 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
KP920_RS27090 154016..154285 + 270 WP_004152102.1 hypothetical protein -
KP920_RS27095 154273..154848 + 576 WP_004152103.1 hypothetical protein -
KP920_RS27100 154879..155373 + 495 WP_004152104.1 DNA-binding protein -
KP920_RS27105 155417..155785 + 369 WP_004152105.1 hypothetical protein -
KP920_RS27110 155819..156022 + 204 WP_004152106.1 hemolysin expression modulator Hha -
KP920_RS27115 156071..156328 + 258 WP_004152107.1 hypothetical protein -
KP920_RS27120 156404..156658 + 255 WP_004152108.1 hypothetical protein -
KP920_RS27125 156834..157100 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
KP920_RS27130 157088..157570 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
KP920_RS27135 157782..159128 + 1347 WP_020314316.1 ISNCY family transposase -
KP920_RS27140 159629..160883 - 1255 Protein_172 IS3 family transposase -
KP920_RS27145 160971..161933 - 963 WP_004152113.1 M48 family metalloprotease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..231732 231732


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T285847 WP_003026803.1 NZ_LR025093:157088-157570 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT285847 WP_003026799.1 NZ_LR025093:156834-157100 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References