Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 82308..82951 Replicon plasmid 2
Accession NZ_LR025093
Organism Klebsiella pneumoniae isolate KP9201

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag KP920_RS26695 Protein ID WP_014386165.1
Coordinates 82535..82951 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag KP920_RS26690 Protein ID WP_032408893.1
Coordinates 82308..82538 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP920_RS26660 77381..78376 - 996 WP_000611945.1 NAD(P)H-quinone oxidoreductase -
KP920_RS26665 78383..79531 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
KP920_RS26670 79702..80859 - 1158 WP_032408895.1 acetylornithine deacetylase -
KP920_RS26675 80875..81549 - 675 WP_014386166.1 DUF1028 domain-containing protein -
KP920_RS26680 81554..81988 - 435 WP_000103648.1 RidA family protein -
KP920_RS26690 82308..82538 + 231 WP_032408893.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
KP920_RS26695 82535..82951 + 417 WP_014386165.1 PIN domain-containing protein Toxin
KP920_RS26700 83274..84242 + 969 WP_074422984.1 IS5 family transposase -
KP920_RS26705 84422..84796 - 375 WP_032408891.1 hypothetical protein -
KP920_RS26710 84852..85178 - 327 WP_004152639.1 hypothetical protein -
KP920_RS26715 85175..85903 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
KP920_RS26720 85900..86331 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / dfrA12 / aadA2 / qacE / sul1 / mph(A) - 1..231732 231732
- flank IS/Tn - - 83274..84242 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T285846 WP_014386165.1 NZ_LR025093:82535-82951 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT285846 WP_032408893.1 NZ_LR025093:82308-82538 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References